NFIB antibody

Catalog No. ABIN5692906

Product Details anti-NFIB Antibody

Target: NFIB (Nuclear Factor I/B (NFIB))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NFIB antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Brand: Picoband™

Sequence: ELVRVSRTPI TQGTGVNFPI GEIPSQPYYH DMNSGVNLQR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for NFIB/NF1B2 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human NFIB/NF1B2 (ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for NFIB

Target: NFIB (Nuclear Factor I/B (NFIB))

Alternative Name: NFIB (NFIB Products)

Synonyms: NFIB antibody, nf1-b1 antibody, CTF antibody, HMGIC/NFIB antibody, NF-I/B antibody, NF1-B antibody, NFI-B antibody, NFI-RED antibody, NFIB2 antibody, NFIB3 antibody, 6720429L07Rik antibody, E030026I10Rik antibody, nuclear factor I B antibody, nuclear factor 1 B-type antibody, nuclear factor I B L homeolog antibody, nuclear factor I/B antibody, NFIB antibody, LOC100221557 antibody, nfib.L antibody, Nfib antibody

Background:

Synonyms: Nuclear factor 1 B-type, NF1-B, Nuclear factor 1/B, CCAAT-box-binding transcription factor, CTF, Nuclear factor I/B, NF-I/B, NFI-B, TGGCA-binding protein, NFIB

UniProt: O00712