ASXL1 antibody
-
- Target See all ASXL1 Antibodies
- ASXL1 (Additional Sex Combs Like 1 (ASXL1))
- Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ASXL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Brand
- Picoband™
- Sequence
- KKERTWAEAA RLVLENYSDA PMTPKQILQV IEAE
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for ASXL1 detection. Tested with WB in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human ASXL1 (KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE).
- Top Product
- Discover our top product ASXL1 Primary Antibody
-
-
- Application Notes
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ASXL1 (Additional Sex Combs Like 1 (ASXL1))
- Alternative Name
- ASXL1 (ASXL1 Products)
- Synonyms
- asxl1 antibody, MGC83850 antibody, mKIAA0978 antibody, BOPS antibody, MDS antibody, additional sex combs like 1, transcriptional regulator L homeolog antibody, additional sex combs like 1, transcriptional regulator antibody, additional sex combs like 1 antibody, asxl1.L antibody, ASXL1 antibody, asxl1 antibody, Asxl1 antibody
- Background
-
Synonyms: Putative Polycomb group protein ASXL1, Additional sex combs-like protein 1, ASXL1, KIAA0978
Tissue Specificity: Widely expressed at low level. Expressed in heart, brain, skeletal muscle, placenta, pancreas, spleen, prostate, small intestine, colon, peripheral blood, leukocytes, bone marrow and fetal liver. Highly expressed in testes.
Background: Putative Polycomb group protein ASXL1 is a protein that in humans is encoded by the ASXL1 gene. This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants.
- Pathways
- Retinoic Acid Receptor Signaling Pathway
-