IFNAR1 antibody (AA 263-306)

Catalog No. ABIN5708183

This Rabbit Polyclonal antibody specifically detects IFNAR1 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for IFNAR1 antibody (AA 263-306) (ABIN5708183)

Target: IFNAR1 (Interferon alpha/beta Receptor 1 (IFNAR1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFNAR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IFNAR1 Antibody

Binding Specificity: AA 263-306

Purification: Antigen affinity purified

Immunogen: Amino acids 263-306 (HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR) from the human protein were used as the immunogen for the IFNAR1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the IFNAR1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the IFNAR1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for IFNAR1

Target: IFNAR1 (Interferon alpha/beta Receptor 1 (IFNAR1))

Alternative Name: IFNAR1 / Interferon alpha receptor 1

Background: Interferon-alpha/beta receptor alpha chain is a protein that in humans is encoded by the IFNAR1 gene. The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.

UniProt: P17181

Pathways: JAK-STAT Signaling, Hepatitis C