ANO1 antibody (CF®405S)
-
- Target See all ANO1 Antibodies
- ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))
-
Reactivity
- Human
-
Host
- Mouse
-
Clonality
- Monoclonal
-
Conjugate
- This ANO1 antibody is conjugated to CF®405S
-
Application
- Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Formalin-fixed Sections) (IHC (f))
- Purpose
- Mouse Monoclonal anti-DOG-1 (DOG1.1), CF405S Conjugate
- Characteristics
- Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4 % vs. 94.7 %. Primary antibodies are available purified, or with a selection of fluorescent CF® dyes and other labels. CF® dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF®405S and CF®405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.
- Immunogen
- A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
- Clone
- DOG1-1
- Isotype
- IgG1 kappa
- Top Product
- Discover our top product ANO1 Primary Antibody
-
-
- Application Notes
-
Immunohistology formalin-fixed 0.25-0.5 μg/mL
- Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes
- Immunofluorescence 0.5-1 μg/mL
- Flow Cytometry 0.5-1 μg/million cells/0.1 mL
- Optimal dilution for a specific application should be determined by user
- Comment
-
Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- 100 μg/mL
- Buffer
- PBS/0.1 % BSA/0.05 % azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Protect from light
-
- Target
- ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))
- Alternative Name
- DOG-1 (ANO1 Products)
- Background
- Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestinal Stromal Tumors Protein-1 (DOG-1),TAOS2, ORAOV2, TMEM16A
- Molecular Weight
- ~114 kDa
- Gene ID
- 55107, 503074
- UniProt
- Q5XXA6
-