ANO1 antibody (CF®488A)

Catalog No. ABIN6172990

The Mouse Monoclonal anti-ANO1 antibody has been validated for IF, FACS and IHC (f). It is suitable to detect ANO1 in samples from Human.

Quick Overview for ANO1 antibody (CF®488A) (ABIN6172990)

Target: ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This ANO1 antibody is conjugated to CF®488A

Application: Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Formalin-fixed Sections) (IHC (f))

Clone: DOG1-1

Product Details anti-ANO1 Antibody (CF®488A)

Purpose: Mouse Monoclonal anti-DOG-1 (DOG1.1), CF488A Conjugate

Characteristics: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4 % vs. 94.7 %. Primary antibodies are available purified, or with a selection of fluorescent CF® dyes and other labels. CF® dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF®405S and CF®405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.

Immunogen: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.

Isotype: IgG1 kappa

Application Details

Application Notes: Immunohistology formalin-fixed 0.25-0.5 μg/mL

• Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM citrate buffer,  pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes
• Immunofluorescence 0.5-1 μg/mL
• Flow Cytometry 0.5-1 μg/million cells/0.1 mL
• Optimal dilution for a specific application should be determined by user

Comment:

Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 100 μg/mL

Buffer: PBS/0.1 % BSA/0.05 % azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Protect from light

Target Details for ANO1

Target: ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))

Alternative Name: DOG-1

Background: Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestinal Stromal Tumors Protein-1 (DOG-1),TAOS2, ORAOV2, TMEM16A

Molecular Weight: ~114 kDa

Gene ID: 55107, 503074

UniProt: Q5XXA6