Neuromedin B antibody (AA 25-55) (Biotin)

Catalog No. ABIN6294425

The Rabbit Polyclonal anti-Neuromedin B antibody has been validated for ELISA. It is suitable to detect Neuromedin B in samples from Human.

Quick Overview for Neuromedin B antibody (AA 25-55) (Biotin) (ABIN6294425)

Target: Neuromedin B

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Neuromedin B antibody is conjugated to Biotin

Application: ELISA

Product Details anti-Neuromedin B Antibody (Biotin)

Binding Specificity: AA 25-55

Purpose: Rabbit Anti-Human NMB (25-55aa) Antibody [+Biotin],

Immunogen: This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen (NMB:25-55aa):APLSWDLPEPRSRASKIRVHSRGNLWATGHFC ).This antibody was produced from a rabbit immunized with this peptide conjugated with KLH.The IgG fraction of tissue culture supernatant was purified by Protein A affinity chromatography.

Application Details

Application Notes: ELISA (recommended work dilution= 1:64,000)

Restrictions: For Research Use only

Handling

Reconstitution: A separate vial of dilution buffer is provided for reconstitution. The antibody is supplied lyophilized, originally containing PBS, without preservative stabilizers (e.g. sodium azide). The final amount is indicated on the shipping vial.

Storage: 4 °C,-20 °C,-80 °C

Storage Comment: -20°C

Target Details for Neuromedin B

Target: Neuromedin B

Alternative Name: Neuromedin-B

Background:

Target Description: Neuromedin B  (NMB) is a  bombesin-related  peptide  in mammals.  It was originally purified from pig spinal cord, and later shown to be present in human  central nervous system  and  gastrointestinal tract.

Gene Symbol: NMB

Gene ID: 4828

UniProt: P08949