NR1H2 antibody (Middle Region)
-
- Target See all NR1H2 Antibodies
- NR1H2 (Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NR1H2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NR1 H2 antibody was raised against the middle region of NR1 2
- Purification
- Purified
- Immunogen
- NR1 H2 antibody was raised using the middle region of NR1 2 corresponding to a region with amino acids MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAI
- Top Product
- Discover our top product NR1H2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NR1H2 Blocking Peptide, catalog no. 33R-6119, is also available for use as a blocking control in assays to test for specificity of this NR1H2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NR1H2 (Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2))
- Alternative Name
- NR1H2 (NR1H2 Products)
- Background
- The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Nuclear Hormone Receptor Binding
-