MBD1 antibody (C-Term)

Catalog No. ABIN629581

This Rabbit Polyclonal antibody specifically detects MBD1 in WB. It exhibits reactivity toward Human and Dog.

Quick Overview for MBD1 antibody (C-Term) (ABIN629581)

Target: MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MBD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MBD1 Antibody

Binding Specificity: C-Term

Specificity: MBD1 antibody was raised against the C terminal of MBD1

Purification: Purified

Immunogen: MBD1 antibody was raised using the C terminal of MBD1 corresponding to a region with amino acids VKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRD

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MBD1 Blocking Peptide, (ABIN5614686), is also available for use as a blocking control in assays to test for specificity of this MBD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MBD1

Target: MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))

Alternative Name: MBD1

Background: MBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD1 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus.

Molecular Weight: 60 kDa (MW of target protein)