USP16 antibody (N-Term)

Catalog No. ABIN629587

Product Details anti-USP16 Antibody

Target: USP16 (Ubiquitin Specific Peptidase 16 (USP16))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This USP16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: USP16 antibody was raised against the N terminal of USP16

Purification: Purified

Immunogen: USP16 antibody was raised using the N terminal of USP16 corresponding to a region with amino acids CKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRS

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

USP16 Blocking Peptide, catalog no. 33R-1726, is also available for use as a blocking control in assays to test for specificity of this USP16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for USP16

Target: USP16 (Ubiquitin Specific Peptidase 16 (USP16))

Alternative Name: USP16 (USP16 Products)

Synonyms: ubp-m antibody, USP16 antibody, UBP-M antibody, 1200004E02Rik antibody, 2810483I07Rik antibody, 6330514E22Rik antibody, UBPM antibody, si:ch211-238e22.5 antibody, si:dkey-121n8.2 antibody, wu:fc76b02 antibody, wu:fc76b08 antibody, universal stress protein antibody, ubiquitin specific peptidase 16 antibody, ubiquitin specific peptidase 16 L homeolog antibody, usp16 antibody, USP16 antibody, Usp16 antibody, usp16.L antibody

Background: USP16 is a deubiquitinating enzyme that is phosphorylated at the onset of mitosis and then dephosphorylated at the metaphase/anaphase transition. It can deubiquitinate H2A, one of two major ubiquitinated proteins of chromatin, in vitro and a mutant form of the protein was shown to block cell division.

Molecular Weight: 44 kDa (MW of target protein)