CRYAB antibody (C-Term)

Catalog No. ABIN629589

The Rabbit Polyclonal anti-CRYAB antibody (ABIN629589) specifically detects CRYAB in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for CRYAB antibody (C-Term) (ABIN629589)

Target: CRYAB (Crystallin, alpha B (CRYAB))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRYAB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CRYAB Antibody

Binding Specificity: C-Term

Specificity: Crystallin Alpha B antibody was raised against the C terminal of CRYAB

Purification: Purified

Immunogen: Crystallin Alpha B antibody was raised using the C terminal of CRYAB corresponding to a region with amino acids KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Crystallin Alpha B Blocking Peptide, (ABIN940136), is also available for use as a blocking control in assays to test for specificity of this Crystallin Alpha B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYAB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRYAB

Target: CRYAB (Crystallin, alpha B (CRYAB))

Alternative Name: Crystallin alpha B

Background: Alpha crystallins are composed of: alpha-A and alpha-B, for acidic and basic, respectively. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone, instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. Alpha-A and alpha-B are differentially expressed, alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases, a missense mutation cosegregated in a family with a desmin-related myopathy.

Molecular Weight: 12 kDa (MW of target protein)