ESRP1 antibody (N-Term)

Catalog No. ABIN629592

This anti-ESRP1 antibody is a Rabbit Polyclonal antibody detecting ESRP1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for ESRP1 antibody (N-Term) (ABIN629592)

Target: ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ESRP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ESRP1 Antibody

Binding Specificity: N-Term

Specificity: RBM35 A antibody was raised against the N terminal of RBM35

Purification: Purified

Immunogen: RBM35 A antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM35A Blocking Peptide, (ABIN5615788), is also available for use as a blocking control in assays to test for specificity of this RBM35A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ESRP1

Target: ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))

Alternative Name: RBM35A

Background: RBM35A functions as a tumor suppressor in colon cancer cells.

Molecular Weight: 68 kDa (MW of target protein)