ESRP1 antibody (N-Term)

Catalog No. ABIN629592

Product Details anti-ESRP1 Antibody

Target: ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ESRP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBM35 A antibody was raised against the N terminal of RBM35

Purification: Purified

Immunogen: RBM35 A antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM35A Blocking Peptide, catalog no. 33R-6542, is also available for use as a blocking control in assays to test for specificity of this RBM35A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ESRP1

Target: ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))

Alternative Name: RBM35A (ESRP1 Products)

Synonyms: rbm35a antibody, RBM35A antibody, RMB35A antibody, 2210008M09Rik antibody, A630065D16 antibody, BC031468 antibody, Rbm35a antibody, RGD1560481 antibody, wu:fi28a07 antibody, zgc:154050 antibody, epithelial splicing regulatory protein 1 antibody, epithelial splicing regulatory protein 1 L homeolog antibody, ESRP1 antibody, esrp1.L antibody, Esrp1 antibody, esrp1 antibody

Background: RBM35A functions as a tumor suppressor in colon cancer cells.

Molecular Weight: 68 kDa (MW of target protein)