CBR1 antibody (C-Term)

Catalog No. ABIN629599

This Rabbit Polyclonal antibody specifically detects CBR1 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for CBR1 antibody (C-Term) (ABIN629599)

Target: CBR1 (Carbonyl Reductase 1 (CBR1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CBR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CBR1 Antibody

Binding Specificity: C-Term

Specificity: Carbonyl Reductase 1 antibody was raised against the C terminal of CBR1

Purification: Purified

Immunogen: Carbonyl Reductase 1 antibody was raised using the C terminal of CBR1 corresponding to a region with amino acids PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carbonyl Reductase 1 Blocking Peptide, catalog no. 33R-7140, is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CBR1

Target: CBR1 (Carbonyl Reductase 1 (CBR1))

Alternative Name: Carbonyl Reductase 1

Background: Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q.

Molecular Weight: 30 kDa (MW of target protein)