CBR1 antibody (C-Term)
-
- Target See all CBR1 Antibodies
- CBR1 (Carbonyl Reductase 1 (CBR1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CBR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Carbonyl Reductase 1 antibody was raised against the C terminal of CBR1
- Purification
- Purified
- Immunogen
- Carbonyl Reductase 1 antibody was raised using the C terminal of CBR1 corresponding to a region with amino acids PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
- Top Product
- Discover our top product CBR1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Carbonyl Reductase 1 Blocking Peptide, catalog no. 33R-7140, is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CBR1 (Carbonyl Reductase 1 (CBR1))
- Alternative Name
- Carbonyl Reductase 1 (CBR1 Products)
- Background
- Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q.
- Molecular Weight
- 30 kDa (MW of target protein)
-