PRMT5 antibody (N-Term)

Catalog No. ABIN629605

Product Details anti-PRMT5 Antibody

Target: PRMT5 (Protein Arginine Methyltransferase 5 (PRMT5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRMT5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PRMT5 antibody was raised against the N terminal of PRMT5

Purification: Purified

Immunogen: PRMT5 antibody was raised using the N terminal of PRMT5 corresponding to a region with amino acids FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRMT5 Blocking Peptide, catalog no. 33R-2864, is also available for use as a blocking control in assays to test for specificity of this PRMT5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRMT5

Target: PRMT5 (Protein Arginine Methyltransferase 5 (PRMT5))

Alternative Name: PRMT5 (PRMT5 Products)

Synonyms: HRMT1L5 antibody, IBP72 antibody, JBP1 antibody, SKB1 antibody, SKB1Hs antibody, Jbp1 antibody, Skb1 antibody, si:zc14a17.2 antibody, skb1 antibody, wu:fb95f10 antibody, zgc:110669 antibody, hsl7 antibody, DDBDRAFT_0187422 antibody, DDBDRAFT_0235403 antibody, DDB_0187422 antibody, DDB_0235403 antibody, NV18830 antibody, jbp1 antibody, ibp72 antibody, skb1hs antibody, hrmt1l5 antibody, protein arginine methyltransferase 5 antibody, protein arginine N-methyltransferase 5 antibody, protein arginine methyltransferase 5 L homeolog antibody, putative arginine N-methyltransferase, type II antibody, Skb1 family protein antibody, Protein arginine N-methyltransferase 5 antibody, PRMT5 antibody, Prmt5 antibody, prmt5 antibody, prmt5.L antibody, LOC100115766 antibody, prmt-5 antibody

Background: PRMT5 methylates specific arginine residues in the small nuclear ribonucleoproteins Sm D1 and Sm D3 to monomethylarginine and to symmetrical dimethylarginines (sDMAs). It methylates SUPT5H. PRMT5 plays a role in the assembly of snRNP core particles and may play a role in cytokine-activated transduction pathways. It negatively regulates cyclin E1 promoter activity and cellular proliferation and May regulate the SUPT5H transcriptional elongation properties. It may be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. PRMT5 methylates histone H2A/H4 'Arg-3' during germ cell development and methylates histone H3 'Arg-8', which may repress transcription.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Chromatin Binding, Regulation of Muscle Cell Differentiation, Ribonucleoprotein Complex Subunit Organization, Skeletal Muscle Fiber Development