RAD23A antibody

Catalog No. ABIN629610

The Rabbit Polyclonal anti-RAD23A antibody (ABIN629610) specifically detects RAD23A in WB and IHC. The antibody is reactive with Human, Mouse, Rat and Dog samples.

Quick Overview for RAD23A antibody (ABIN629610)

Target: RAD23A (RAD23 Homolog A (RAD23A))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAD23A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-RAD23A Antibody

Purification: Purified

Immunogen: RAD23 A antibody was raised using a synthetic peptide corresponding to a region with amino acids GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAD23A Blocking Peptide, (ABIN938725), is also available for use as a blocking control in assays to test for specificity of this RAD23A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAD23A

Target: RAD23A (RAD23 Homolog A (RAD23A))

Alternative Name: RAD23A

Background: RAD23A is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: DNA Damage Repair