RAD23A antibody
-
- Target See all RAD23A Antibodies
- RAD23A (RAD23 Homolog A (RAD23A))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAD23A antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- RAD23 A antibody was raised using a synthetic peptide corresponding to a region with amino acids GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ
- Top Product
- Discover our top product RAD23A Primary Antibody
-
anti-RAD23 Homolog A (RAD23A) (AA 1-363) antibody
RAD23A Reactivity: Human WB, ELISA, IHC, ICC, FACS Host: Mouse Monoclonal 3E3F4 unconjugated
anti-RAD23 Homolog A (RAD23A) (AA 151-250) antibodyRAD23A Reactivity: Human WB, ELISA, RNAi Host: Mouse Monoclonal 3C12 unconjugated
anti-RAD23 Homolog A (RAD23A) antibodyRAD23A Reactivity: Human WB, IF Host: Rabbit Monoclonal unconjugated
anti-RAD23 Homolog A (RAD23A) (AA 2-201) antibodyRAD23A Reactivity: Human WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-RAD23 Homolog A (RAD23A) (C-Term) antibodyRAD23A Reactivity: Human, Mouse, Rat WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-RAD23 Homolog A (RAD23A) (AA 303-333), (C-Term) antibodyRAD23A Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB4541-4542 unconjugated
anti-RAD23 Homolog A (RAD23A) (AA 122-135) antibodyRAD23A Reactivity: Human WB, ELISA Host: Goat Polyclonal unconjugated
anti-RAD23 Homolog A (RAD23A) (AA 201-250) antibodyRAD23A Reactivity: Human, Mouse, Rat, Dog, Rabbit, Horse, Cow, Pig, Monkey, Bat WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-RAD23 Homolog A (RAD23A) (AA 141-190) antibodyRAD23A Reactivity: Human, Mouse, Rat, Dog, Rabbit, Horse, Guinea Pig, Pig, Monkey, Bat WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-RAD23 Homolog A (RAD23A) (C-Term) antibodyRAD23A Reactivity: Human, Mouse WB, ELISA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAD23A Blocking Peptide, catalog no. 33R-3339, is also available for use as a blocking control in assays to test for specificity of this RAD23A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAD23A (RAD23 Homolog A (RAD23A))
- Alternative Name
- RAD23A (RAD23A Products)
- Synonyms
- rad23a antibody, wu:fe11h06 antibody, zgc:92001 antibody, RAD23A antibody, HHR23A antibody, HR23A antibody, 2310040P19Rik antibody, AL024030 antibody, mHR23A antibody, RAD23 homolog A, nucleotide excision repair protein a antibody, RAD23 homolog A, nucleotide excision repair protein antibody, rad23aa antibody, RAD23A antibody, Rad23a antibody
- Background
- RAD23A is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-
