Cnpase antibody (N-Term)
-
- Target See all Cnpase (CNP) Antibodies
- Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cnpase antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CNP antibody was raised against the N terminal of CNP
- Purification
- Purified
- Immunogen
- CNP antibody was raised using the N terminal of CNP corresponding to a region with amino acids YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF
- Top Product
- Discover our top product CNP Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CNP Blocking Peptide, catalog no. 33R-10149, is also available for use as a blocking control in assays to test for specificity of this CNP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))
- Alternative Name
- CNP (CNP Products)
- Background
- 2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm.
- Molecular Weight
- 45 kDa (MW of target protein)
-