Cnpase antibody (N-Term)

Catalog No. ABIN629627

The Rabbit Polyclonal anti-Cnpase antibody has been validated for WB. It is suitable to detect Cnpase in samples from Human.

Quick Overview for Cnpase antibody (N-Term) (ABIN629627)

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cnpase antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Cnpase Antibody

Binding Specificity: N-Term

Specificity: CNP antibody was raised against the N terminal of CNP

Purification: Purified

Immunogen: CNP antibody was raised using the N terminal of CNP corresponding to a region with amino acids YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CNP Blocking Peptide, (ABIN936115), is also available for use as a blocking control in assays to test for specificity of this CNP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cnpase

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Alternative Name: CNP

Background: 2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm.

Molecular Weight: 45 kDa (MW of target protein)