Cnpase antibody (N-Term)

Catalog No. ABIN629627

Product Details anti-Cnpase Antibody

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cnpase antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CNP antibody was raised against the N terminal of CNP

Purification: Purified

Immunogen: CNP antibody was raised using the N terminal of CNP corresponding to a region with amino acids YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CNP Blocking Peptide, catalog no. 33R-10149, is also available for use as a blocking control in assays to test for specificity of this CNP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cnpase

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Alternative Name: CNP (CNP Products)

Synonyms: CNP1 antibody, CNPase antibody, Cnp-1 antibody, Cnp1 antibody, CNPF antibody, CNPI antibody, CNPII antibody, CNP antibody, DKFZp469F1421 antibody, cnpl antibody, fd21d08 antibody, fi37a10 antibody, rich antibody, sb:cb662 antibody, si:ch73-158e11.4 antibody, wu:fd21d08 antibody, wu:fd44a05 antibody, wu:fi35d08 antibody, wu:fi37a10 antibody, cnp antibody, 2',3'-cyclic nucleotide 3' phosphodiesterase antibody, CNP antibody, Cnp antibody, cnp antibody, cnp.L antibody

Background: 2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm.

Molecular Weight: 45 kDa (MW of target protein)