RSRC2 antibody (C-Term)

Catalog No. ABIN629642

The Rabbit Polyclonal anti-RSRC2 antibody is suitable to detect RSRC2 in samples from Human, Dog, Mouse and Rat. It has been validated for WB and IHC.

Quick Overview for RSRC2 antibody (C-Term) (ABIN629642)

Target: RSRC2 (arginine/serine-Rich Coiled-Coil 2 (RSRC2))

Reactivity: Human, Dog, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RSRC2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-RSRC2 Antibody

Binding Specificity: C-Term

Specificity: RSRC2 antibody was raised against the C terminal of RSRC2

Purification: Purified

Immunogen: RSRC2 antibody was raised using the C terminal of RSRC2 corresponding to a region with amino acids DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RSRC2 Blocking Peptide, (ABIN937520), is also available for use as a blocking control in assays to test for specificity of this RSRC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSRC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RSRC2

Target: RSRC2 (arginine/serine-Rich Coiled-Coil 2 (RSRC2))

Alternative Name: RSRC2

Background: In vitro study revealed that RSRC2 might play a role in cell proliferation. RSRC2 may be a novel tumor suppressor of esophageal cancer cell growth.

Molecular Weight: 50 kDa (MW of target protein)