ACAT2 antibody

Catalog No. ABIN629656

Product Details anti-ACAT2 Antibody

Target: ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACAT2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS

Application Details

Application Notes: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACAT2 Blocking Peptide, catalog no. 33R-9686, is also available for use as a blocking control in assays to test for specificity of this ACAT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACAT2

Target: ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))

Alternative Name: ACAT2 (ACAT2 Products)

Synonyms: fb10a06 antibody, fb53f08 antibody, wu:fb10a06 antibody, wu:fb53f08 antibody, AW742799 antibody, Tcp-1x antibody, Tcp1-rs1 antibody, Ab2-076 antibody, Acat3 antibody, EMB1276 antibody, EMBRYO DEFECTIVE 1276 antibody, MIF21.12 antibody, MIF21_12 antibody, acetoacetyl-CoA thiolase 2 antibody, acetyl-CoA acetyltransferase 2 antibody, acetyl-Coenzyme A acyltransferase 2 antibody, acetyl-Coenzyme A acetyltransferase 2 antibody, acetyl-CoA acetyltransferase 2 S homeolog antibody, acetoacetyl-CoA thiolase 2 antibody, ACAT2 antibody, CNA05060 antibody, acat2 antibody, Acat2 antibody, acat2.S antibody

Background: Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 genehows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Molecular Weight: 44 kDa (MW of target protein)