Liver Arginase antibody (Arg1, N-Term)

Catalog No. ABIN629657

The Rabbit Polyclonal anti-Liver Arginase antibody has been validated for WB and IHC. It is suitable to detect Liver Arginase in samples from Human, Rat and Dog.

Quick Overview for Liver Arginase antibody (Arg1, N-Term) (ABIN629657)

Target: Liver Arginase (ARG1) (Arginase, Liver (ARG1))

Reactivity: Human, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Liver Arginase antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Liver Arginase Antibody

Binding Specificity: Arg1, N-Term

Specificity: Arginase 1 antibody was raised against the N terminal of ARG1

Purification: Purified

Immunogen: Arginase 1 antibody was raised using the N terminal of ARG1 corresponding to a region with amino acids HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Arginase 1 Blocking Peptide, (ABIN939241), is also available for use as a blocking control in assays to test for specificity of this Arginase 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Liver Arginase

Target: Liver Arginase (ARG1) (Arginase, Liver (ARG1))

Alternative Name: Arginase 1

Background: Arginase catalyzes the hydrolysis of arginine to ornithine and urea. The type I isoform of ARG1, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin