Liver Arginase antibody (Arg1, N-Term)

Catalog No. ABIN629657

Product Details anti-Liver Arginase Antibody

Target: Liver Arginase (ARG1) (Arginase, Liver (ARG1))

Binding Specificity: Arg1, N-Term

Reactivity: Human, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Liver Arginase antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Arginase 1 antibody was raised against the N terminal of ARG1

Purification: Purified

Immunogen: Arginase 1 antibody was raised using the N terminal of ARG1 corresponding to a region with amino acids HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Arginase 1 Blocking Peptide, catalog no. 33R-3855, is also available for use as a blocking control in assays to test for specificity of this Arginase 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Liver Arginase

Target: Liver Arginase (ARG1) (Arginase, Liver (ARG1))

Alternative Name: Arginase 1 (ARG1 Products)

Synonyms: SI:zC146F4.4 (novel protein with NUDIX domain) antibody, si:ch211-146f4.3 antibody, argi1 antibody, AI antibody, AI256583 antibody, Arg-1 antibody, PGIF antibody, arginase 1 antibody, arginase antibody, Arginase-1 antibody, arginase, liver antibody, L-arginase antibody, arg1 antibody, PGTG_16455 antibody, argi1 antibody, ARG1 antibody, Arg1 antibody

Background: Arginase catalyzes the hydrolysis of arginine to ornithine and urea. The type I isoform of ARG1, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin