AK4 antibody (Middle Region)

Catalog No. ABIN629661

This anti-AK4 antibody is a Rabbit Polyclonal antibody detecting AK4 in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for AK4 antibody (Middle Region) (ABIN629661)

Target: AK4 (Adenylate Kinase 4 (AK4))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AK4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AK4 Antibody

Binding Specificity: Middle Region

Specificity: AK3 L1 antibody was raised against the middle region of AK3 1

Purification: Purified

Immunogen: AK3 L1 antibody was raised using the middle region of AK3 1 corresponding to a region with amino acids RWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYK

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AK3L1 Blocking Peptide, (ABIN5611986), is also available for use as a blocking control in assays to test for specificity of this AK3L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AK4

Target: AK4 (Adenylate Kinase 4 (AK4))

Alternative Name: AK3L1

Background: AK3L1 is a member of the adenylate kinase family of enzymes. The protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process