ALDH4A1 antibody (N-Term)

Catalog No. ABIN629678

The Rabbit Polyclonal anti-ALDH4A1 antibody has been validated for WB and IHC. It is suitable to detect ALDH4A1 in samples from Human.

Quick Overview for ALDH4A1 antibody (N-Term) (ABIN629678)

Target: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH4A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-ALDH4A1 Antibody

Binding Specificity: N-Term

Specificity: ALDH4 A1 antibody was raised against the N terminal of ALDH4 1

Purification: Purified

Immunogen: ALDH4 A1 antibody was raised using the N terminal of ALDH4 1 corresponding to a region with amino acids QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALDH4A1 Blocking Peptide, (ABIN5612011), is also available for use as a blocking control in assays to test for specificity of this ALDH4A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALDH4A1

Target: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Alternative Name: ALDH4A1

Background: ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process