ALDH4A1 antibody (C-Term)

Catalog No. ABIN629679

Product Details anti-ALDH4A1 Antibody

Target: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH4A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ALDH4 A1 antibody was raised against the C terminal of ALDH4 1

Purification: Purified

Immunogen: ALDH4 A1 antibody was raised using the C terminal of ALDH4 1 corresponding to a region with amino acids RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVI

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALDH4A1 Blocking Peptide, catalog no. 33R-8071, is also available for use as a blocking control in assays to test for specificity of this ALDH4A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALDH4A1

Target: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Alternative Name: ALDH4A1 (ALDH4A1 Products)

Synonyms: aldh4 antibody, p5cd antibody, p5cdh antibody, ALDH4 antibody, P5CD antibody, P5CDh antibody, A930035F14Rik antibody, Ahd-1 antibody, Ahd1 antibody, Aldh4 antibody, Aldh5a1 antibody, E330022C09 antibody, P5cd antibody, P5cdh antibody, P5cdhl antibody, P5cdhs antibody, Ssdh1 antibody, zgc:63592 antibody, aldehyde dehydrogenase 4 family member A1 antibody, aldehyde dehydrogenase 4 family, member A1 antibody, aldehyde dehydrogenase 4 family member A1 L homeolog antibody, aldh4a1 antibody, ALDH4A1 antibody, Aldh4a1 antibody, aldh4a1.L antibody

Background: ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.

Molecular Weight: 62 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process