NDRG1 antibody (N-Term)

Catalog No. ABIN629694

This anti-NDRG1 antibody is a Rabbit Polyclonal antibody detecting NDRG1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for NDRG1 antibody (N-Term) (ABIN629694)

Target: NDRG1 (N-Myc Downstream Regulated 1 (NDRG1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NDRG1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NDRG1 Antibody

Binding Specificity: N-Term

Specificity: NDRG1 antibody was raised against the N terminal of NDRG1

Purification: Purified

Immunogen: NDRG1 antibody was raised using the N terminal of NDRG1 corresponding to a region with amino acids MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDRG1 Blocking Peptide, (ABIN5614939), is also available for use as a blocking control in assays to test for specificity of this NDRG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDRG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NDRG1

Target: NDRG1 (N-Myc Downstream Regulated 1 (NDRG1))

Alternative Name: NDRG1

Background: NDRG1 is a member of the N-myc downregulated protein family which belongs to the alpha/beta hydrolase superfamily. NDRG1 is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. Mutation in its gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom.

Molecular Weight: 43 kDa (MW of target protein)