NDRG1 antibody (N-Term)
-
- Target See all NDRG1 Antibodies
- NDRG1 (N-Myc Downstream Regulated 1 (NDRG1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NDRG1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NDRG1 antibody was raised against the N terminal of NDRG1
- Purification
- Purified
- Immunogen
- NDRG1 antibody was raised using the N terminal of NDRG1 corresponding to a region with amino acids MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG
- Top Product
- Discover our top product NDRG1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NDRG1 Blocking Peptide, catalog no. 33R-6485, is also available for use as a blocking control in assays to test for specificity of this NDRG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDRG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDRG1 (N-Myc Downstream Regulated 1 (NDRG1))
- Alternative Name
- NDRG1 (NDRG1 Products)
- Synonyms
- CAP43 antibody, CMT4D antibody, DRG-1 antibody, DRG1 antibody, GC4 antibody, HMSNL antibody, NDR1 antibody, NMSL antibody, PROXY1 antibody, RIT42 antibody, RTP antibody, TARG1 antibody, TDD5 antibody, Ndr1 antibody, Ndrl antibody, cap43 antibody, cmt4d antibody, drg1 antibody, gc4 antibody, hmsnl antibody, ndr1 antibody, ndrg1 antibody, nmsl antibody, proxy1 antibody, rit42 antibody, rtp antibody, targ1 antibody, tdd5 antibody, xndrg1 antibody, ndrg4 antibody, cb775 antibody, wu:fb60h02 antibody, zgc:63944 antibody, NDRG1 antibody, NON-RACE SPECIFIC DISEASE RESISTANCE PROTEIN antibody, non race-specific disease resistance 1 antibody, ndrg1-a antibody, ndrg1-b antibody, xNDRG1-A antibody, ndrg1l antibody, zgc:73047 antibody, N-myc downstream regulated 1 antibody, N-myc downstream regulated gene 1 antibody, N-myc downstream regulated 1 S homeolog antibody, N-myc downstream regulated 1a antibody, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family antibody, N-myc downstream regulated 1 L homeolog antibody, N-myc downstream regulated 1b antibody, NDRG1 antibody, Ndrg1 antibody, ndrg1.S antibody, ndrg1 antibody, ndrg1a antibody, NDR1 antibody, ndrg1.L antibody, ndrg1b antibody
- Background
- NDRG1 is a member of the N-myc downregulated protein family which belongs to the alpha/beta hydrolase superfamily. NDRG1 is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. Mutation in its gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom.
- Molecular Weight
- 43 kDa (MW of target protein)
-