RGS20 antibody (N-Term)

Catalog No. ABIN629702

The Rabbit Polyclonal anti-RGS20 antibody has been validated for WB. It is suitable to detect RGS20 in samples from Human.

Quick Overview for RGS20 antibody (N-Term) (ABIN629702)

Target: RGS20 (Regulator of G-Protein Signaling 20 (RGS20))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RGS20 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RGS20 Antibody

Binding Specificity: N-Term

Specificity: RGS20 antibody was raised against the N terminal of RGS20

Purification: Purified

Immunogen: RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RGS20 Blocking Peptide, (ABIN939799), is also available for use as a blocking control in assays to test for specificity of this RGS20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RGS20

Target: RGS20 (Regulator of G-Protein Signaling 20 (RGS20))

Alternative Name: RGS20

Background: Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi and Gq class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling