LKB1 antibody (N-Term)

Catalog No. ABIN629708

The Rabbit Polyclonal anti-LKB1 antibody has been validated for WB and IHC. It is suitable to detect LKB1 in samples from Human, Mouse, Rat, Zebrafish (Danio rerio) and Dog.

Quick Overview for LKB1 antibody (N-Term) (ABIN629708)

Target: LKB1 (STK11) (serine/threonine Kinase 11 (STK11))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LKB1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-LKB1 Antibody

Binding Specificity: N-Term

Specificity: STK11 antibody was raised against the N terminal of STK11

Purification: Purified

Immunogen: STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STK11 Blocking Peptide, (ABIN5616437), is also available for use as a blocking control in assays to test for specificity of this STK11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LKB1

Target: LKB1 (STK11) (serine/threonine Kinase 11 (STK11))

Alternative Name: STK11

Background: STK11is a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in its gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: AMPK Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effect