RGS20 antibody (Middle Region)

Catalog No. ABIN629716

This Rabbit Polyclonal antibody specifically detects RGS20 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for RGS20 antibody (Middle Region) (ABIN629716)

Target: RGS20 (Regulator of G-Protein Signaling 20 (RGS20))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RGS20 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-RGS20 Antibody

Binding Specificity: Middle Region

Specificity: RGS20 antibody was raised against the middle region of RGS20

Purification: Purified

Immunogen: RGS20 antibody was raised using the middle region of RGS20 corresponding to a region with amino acids NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RGS20 Blocking Peptide, (ABIN5615846), is also available for use as a blocking control in assays to test for specificity of this RGS20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RGS20

Target: RGS20 (Regulator of G-Protein Signaling 20 (RGS20))

Alternative Name: RGS20

Background: Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling