RGS13 antibody (Middle Region)

Catalog No. ABIN629717

Product Details anti-RGS13 Antibody

Target: RGS13 (Regulator of G-Protein Signaling 13 (RGS13))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RGS13 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RGS13 antibody was raised against the middle region of RGS13

Purification: Purified

Immunogen: RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RGS13 Blocking Peptide, catalog no. 33R-10015, is also available for use as a blocking control in assays to test for specificity of this RGS13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RGS13

Target: RGS13 (Regulator of G-Protein Signaling 13 (RGS13))

Alternative Name: RGS13 (RGS13 Products)

Synonyms: RGD1562103 antibody, regulator of G protein signaling 13 antibody, regulator of G-protein signaling 13 antibody, RGS13 antibody, Rgs13 antibody

Background: RGS13 encodes a protein which is a member of the regulator of G protein signaling (RGS) family. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation.

Molecular Weight: 19 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling