UBE2K antibody (N-Term)

Catalog No. ABIN629721

This anti-UBE2K antibody is a Rabbit Polyclonal antibody detecting UBE2K in WB. Suitable for Human, Mouse, Rat, Zebrafish (Danio rerio) and Dog.

Quick Overview for UBE2K antibody (N-Term) (ABIN629721)

Target: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2K antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBE2K Antibody

Binding Specificity: N-Term

Specificity: HIP2 antibody was raised against the N terminal of HIP2

Purification: Purified

Immunogen: HIP2 antibody was raised using the N terminal of HIP2 corresponding to a region with amino acids MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTP

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HIP2 Blocking Peptide, (ABIN5614004), is also available for use as a blocking control in assays to test for specificity of this HIP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2K

Target: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Alternative Name: HIP2

Background: HIP2 belongs to the ubiquitin-conjugating enzyme family. It binds selectively to a large region at the N terminus of huntingtin. This interaction is not influenced by the length of the huntingtin polyglutamine tract. This protein has been implicated in the degradation of huntingtin and suppression of apoptosis.

Molecular Weight: 22 kDa (MW of target protein)