FBXL5 antibody (Middle Region)

Catalog No. ABIN629723

The Rabbit Polyclonal anti-FBXL5 antibody is suitable to detect FBXL5 in samples from Human. It has been validated for WB and IHC.

Quick Overview for FBXL5 antibody (Middle Region) (ABIN629723)

Target: FBXL5 (F-Box and Leucine-Rich Repeat Protein 5 (FBXL5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXL5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-FBXL5 Antibody

Binding Specificity: Middle Region

Specificity: FBXL5 antibody was raised against the middle region of FBXL5

Purification: Purified

Immunogen: FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXL5 Blocking Peptide, (ABIN5613533), is also available for use as a blocking control in assays to test for specificity of this FBXL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXL5

Target: FBXL5 (F-Box and Leucine-Rich Repeat Protein 5 (FBXL5))

Alternative Name: FBXL5

Background: FBXL5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL5 belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.

Molecular Weight: 76 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis