UBR7 antibody (C-Term)

Catalog No. ABIN629727

This anti-UBR7 antibody is a Rabbit Polyclonal antibody detecting UBR7 in WB and IHC. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for UBR7 antibody (C-Term) (ABIN629727)

Target: UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBR7 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-UBR7 Antibody

Binding Specificity: C-Term

Specificity: C14 ORF130 antibody was raised against the C terminal Of C14 rf130

Purification: Purified

Immunogen: C14 ORF130 antibody was raised using the C terminal Of C14 rf130 corresponding to a region with amino acids DRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKRED

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C14ORF130 Blocking Peptide, (ABIN937534), is also available for use as a blocking control in assays to test for specificity of this C14ORF130 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBR7

Target: UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))

Alternative Name: C14ORF130

Background: The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 30 kDa (MW of target protein)