UBE2N antibody

Catalog No. ABIN629730

The Rabbit Polyclonal anti-UBE2N antibody (ABIN629730) specifically detects UBE2N in WB. The antibody is reactive with Human, Rat, Mouse, Zebrafish (Danio rerio), Dog and Drosophila melanogaster samples.

Quick Overview for UBE2N antibody (ABIN629730)

Target: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Reactivity: Human, Rat, Mouse, Zebrafish (Danio rerio), Dog, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2N antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBE2N Antibody

Purification: Purified

Immunogen: UBE2 N antibody was raised using a synthetic peptide corresponding to a region with amino acids VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2N Blocking Peptide, (ABIN5616876), is also available for use as a blocking control in assays to test for specificity of this UBE2N antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2N

Target: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Alternative Name: UBE2N

Background: UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: TCR Signaling, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades, Positive Regulation of Response to DNA Damage Stimulus, Ubiquitin Proteasome Pathway