alpha Actinin 4 antibody (N-Term)

Catalog No. ABIN629744

Product Details anti-alpha Actinin 4 Antibody

Target: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This alpha Actinin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Alpha Actinin 4 antibody was raised against the N terminal of ACTN4

Purification: Purified

Immunogen: alpha Actinin 4 antibody was raised using the N terminal of ACTN4 corresponding to a region with amino acids LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA

Application Details

Application Notes: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Alpha Actinin 4 Blocking Peptide, catalog no. 33R-5045, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for alpha Actinin 4

Target: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Alternative Name: alpha Actinin 4 (ACTN4 Products)

Synonyms: fsgs antibody, fsgs1 antibody, C77391 antibody, ACTININ-4 antibody, FSGS antibody, FSGS1 antibody, wu:fb53f05 antibody, zgc:63508 antibody, actinin alpha 4 antibody, actinin, alpha 4 antibody, actinin alpha 4 S homeolog antibody, actn4 antibody, ACTN4 antibody, Actn4 antibody, actn4.S antibody

Background: Alpha actinins belong to the spectrin superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Alpha actinin is an actin-binding protein with multiple roles in different cell types.

Molecular Weight: 100 kDa (MW of target protein)

Pathways: Proton Transport