BHMT antibody (C-Term)

Catalog No. ABIN629748

This anti-BHMT antibody is a Rabbit Polyclonal antibody detecting BHMT in WB and IHC. Suitable for Human and Dog.

Quick Overview for BHMT antibody (C-Term) (ABIN629748)

Target: BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BHMT antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-BHMT Antibody

Binding Specificity: C-Term

Specificity: BHMT antibody was raised against the C terminal of BHMT

Purification: Purified

Immunogen: BHMT antibody was raised using the C terminal of BHMT corresponding to a region with amino acids KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BHMT Blocking Peptide, (ABIN939800), is also available for use as a blocking control in assays to test for specificity of this BHMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BHMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BHMT

Target: BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))

Alternative Name: BHMT

Background: BHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in its gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process