SEPHS1 antibody (C-Term)

Catalog No. ABIN629776

Product Details anti-SEPHS1 Antibody

Target: SEPHS1 (Selenophosphate Synthetase 1 (SEPHS1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SEPHS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SEPHS1 antibody was raised against the C terminal of SEPHS1

Purification: Purified

Immunogen: SEPHS1 antibody was raised using the C terminal of SEPHS1 corresponding to a region with amino acids PKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SEPHS1 Blocking Peptide, catalog no. 33R-7181, is also available for use as a blocking control in assays to test for specificity of this SEPHS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEPHS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SEPHS1

Target: SEPHS1 (Selenophosphate Synthetase 1 (SEPHS1))

Alternative Name: SEPHS1 (SEPHS1 Products)

Synonyms: Sps1 antibody, SEPHS1 antibody, SEPHS1_tv1 antibody, 1110046B24Rik antibody, AA589574 antibody, AI505014 antibody, AW111620 antibody, SELD antibody, SPS antibody, SPS1 antibody, wu:fc49b09 antibody, zgc:55304 antibody, selenophosphate synthetase 1 antibody, selenophosphate synthetase 1 L homeolog antibody, sucrose phosphate synthase 1 antibody, sucrose-phosphate synthase antibody, SEPHS1 antibody, sephs1 antibody, Sps1 antibody, Sephs1 antibody, sephs1.L antibody, sps1 antibody, sps antibody

Background: SEPHS1 is an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons.

Molecular Weight: 43 kDa (MW of target protein)