TIGD3 antibody (N-Term)

Catalog No. ABIN629782

This Rabbit Polyclonal antibody specifically detects TIGD3 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TIGD3 antibody (N-Term) (ABIN629782)

Target: TIGD3 (Tigger Transposable Element Derived 3 (TIGD3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TIGD3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TIGD3 Antibody

Binding Specificity: N-Term

Specificity: TIGD3 antibody was raised against the N terminal of TIGD3

Purification: Purified

Immunogen: TIGD3 antibody was raised using the N terminal of TIGD3 corresponding to a region with amino acids NKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGP

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TIGD3 Blocking Peptide, (ABIN5616602), is also available for use as a blocking control in assays to test for specificity of this TIGD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIGD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TIGD3

Target: TIGD3 (Tigger Transposable Element Derived 3 (TIGD3))

Alternative Name: TIGD3

Background: TIGD3 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of TIGD3 gene is not known.

Molecular Weight: 52 kDa (MW of target protein)