SLC38A4 antibody (Middle Region)

Catalog No. ABIN629787

This anti-SLC38A4 antibody is a Rabbit Polyclonal antibody detecting SLC38A4 in WB and IHC. Suitable for Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), C. elegans and Drosophila melanogaster.

Quick Overview for SLC38A4 antibody (Middle Region) (ABIN629787)

Target: SLC38A4 (Solute Carrier Family 38 Member 4 (SLC38A4))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), C. elegans, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC38A4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SLC38A4 Antibody

Binding Specificity: Middle Region

Specificity: SLC38 A4 antibody was raised against the middle region of SLC38 4

Purification: Purified

Immunogen: SLC38 A4 antibody was raised using the middle region of SLC38 4 corresponding to a region with amino acids LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC38A4 Blocking Peptide, (ABIN940141), is also available for use as a blocking control in assays to test for specificity of this SLC38A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC38A4

Target: SLC38A4 (Solute Carrier Family 38 Member 4 (SLC38A4))

Alternative Name: SLC38A4

Background: SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.

Molecular Weight: 17 kDa (MW of target protein)