CES1 antibody

Catalog No. ABIN629796

Product Details anti-CES1 Antibody

Target: CES1 (Carboxylesterase 1 (CES1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CES1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: Carboxylesterase 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxylesterase 1 Blocking Peptide, catalog no. 33R-1397, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CES1

Target: CES1 (Carboxylesterase 1 (CES1))

Alternative Name: Carboxylesterase 1 (CES1 Products)

Background: CES1 is one of the enzymes responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. This enzyme is known to hydrolyze aromatic and aliphatic esters and is necessary for cellular cholesterol esterification. It may also play a role in detoxification in the lung and/or protection of the central nervous system from ester or amide compounds. Carboxylesterase deficiency may be associated with non-Hodgkin lymphoma or B-cell lymphocytic leukemia.

Molecular Weight: 62 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process