DCTPP1 antibody (N-Term)

Catalog No. ABIN629798

The Rabbit Polyclonal anti-DCTPP1 antibody has been validated for WB. It is suitable to detect DCTPP1 in samples from Human.

Quick Overview for DCTPP1 antibody (N-Term) (ABIN629798)

Target: DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCTPP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DCTPP1 Antibody

Binding Specificity: N-Term

Specificity: XTP3 TPA antibody was raised against the N terminal of XTP3 PA

Purification: Purified

Immunogen: XTP3 TPA antibody was raised using the N terminal of XTP3 PA corresponding to a region with amino acids MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XTP3TPA Blocking Peptide, (ABIN5617049), is also available for use as a blocking control in assays to test for specificity of this XTP3TPA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XTP0 PA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCTPP1

Target: DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))

Alternative Name: XTP3TPA

Background: XTP3TPA is involved in identical protein binding, dCTP diphosphatase activity, pyrimidine deoxyribonucleotide binding and hydrolase activity.

Molecular Weight: 19 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome