TARS antibody (N-Term)

Catalog No. ABIN629800

This Rabbit Polyclonal antibody specifically detects TARS in WB and IHC. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for TARS antibody (N-Term) (ABIN629800)

Target: TARS (threonyl-tRNA Synthetase (TARS))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TARS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-TARS Antibody

Binding Specificity: N-Term

Specificity: TARS antibody was raised against the N terminal of TARS

Purification: Purified

Immunogen: TARS antibody was raised using the N terminal of TARS corresponding to a region with amino acids PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TARS Blocking Peptide, (ABIN5616506), is also available for use as a blocking control in assays to test for specificity of this TARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TARS

Target: TARS (threonyl-tRNA Synthetase (TARS))

Alternative Name: TARS

Background: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Threonyl-tRNA synthetase belongs to the class-II aminoacyl-tRNA synthetase family.

Molecular Weight: 78 kDa (MW of target protein)