PKLR antibody (N-Term)

Catalog No. ABIN629803

This Rabbit Polyclonal antibody specifically detects PKLR in WB and IHC. It exhibits reactivity toward Human, Mouse, Rat, Dog and C. elegans.

Quick Overview for PKLR antibody (N-Term) (ABIN629803)

Target: PKLR (Pyruvate Kinase, Liver and RBC (PKLR))

Reactivity: Human, Mouse, Rat, Dog, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PKLR antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PKLR Antibody

Binding Specificity: N-Term

Specificity: PKLR antibody was raised against the N terminal of PKLR

Purification: Purified

Immunogen: PKLR antibody was raised using the N terminal of PKLR corresponding to a region with amino acids STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PKLR Blocking Peptide, (ABIN5615398), is also available for use as a blocking control in assays to test for specificity of this PKLR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PKLR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PKLR

Target: PKLR (Pyruvate Kinase, Liver and RBC (PKLR))

Alternative Name: PKLR

Background: PKLR is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA).

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process