Desmin antibody (N-Term)

Catalog No. ABIN629811

This anti-Desmin antibody is a Rabbit Polyclonal antibody detecting Desmin in WB. Suitable for Human, Rat and Mouse.

Quick Overview for Desmin antibody (N-Term) (ABIN629811)

Target: Desmin (DES)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Desmin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Desmin Antibody

Binding Specificity: N-Term

Specificity: Desmin antibody was raised against the N terminal of DES

Purification: Purified

Immunogen: Desmin antibody was raised using the N terminal of DES corresponding to a region with amino acids PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Desmin Blocking Peptide, (ABIN5613181), is also available for use as a blocking control in assays to test for specificity of this Desmin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DES antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Desmin

Target: Desmin (DES)

Alternative Name: Desmin

Background: DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Molecular Weight: 52 kDa (MW of target protein)