Desmin antibody (N-Term)
-
- Target See all Desmin (DES) Antibodies
- Desmin (DES)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Desmin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Desmin antibody was raised against the N terminal of DES
- Purification
- Purified
- Immunogen
- Desmin antibody was raised using the N terminal of DES corresponding to a region with amino acids PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR
- Top Product
- Discover our top product DES Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Desmin Blocking Peptide, catalog no. 33R-7209, is also available for use as a blocking control in assays to test for specificity of this Desmin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DES antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Desmin (DES)
- Alternative Name
- Desmin (DES Products)
- Synonyms
- DES antibody, des-b antibody, MGC80853 antibody, des antibody, csm1 antibody, csm2 antibody, desm antibody, cmd1i antibody, MGC75911 antibody, LOC100220724 antibody, desmin antibody, cb290 antibody, fb59a12 antibody, wu:fb59a12 antibody, zgc:109859 antibody, CSM1 antibody, CSM2 antibody, LGMD2R antibody, wu:fc11d08 antibody, zgc:154009 antibody, des-a antibody, MGC52614 antibody, desmin antibody, desmin, gene 1 L homeolog antibody, desmin, gene 1 antibody, desmin a antibody, desmin b antibody, desmin, gene 1 S homeolog antibody, desmin, gene 2 S homeolog antibody, DES antibody, des.1.L antibody, des.1 antibody, des antibody, desma antibody, Des antibody, desmb antibody, des.1.S antibody, des.2.S antibody
- Background
- DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.
- Molecular Weight
- 52 kDa (MW of target protein)
-