PRMT1 antibody (Middle Region)

Catalog No. ABIN629816

The Rabbit Polyclonal anti-PRMT1 antibody is suitable to detect PRMT1 in samples from Human, Mouse, Rat, Dog and Zebrafish (Danio rerio). It has been validated for WB and IHC.

Quick Overview for PRMT1 antibody (Middle Region) (ABIN629816)

Target: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRMT1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PRMT1 Antibody

Binding Specificity: Middle Region

Specificity: PRMT1 antibody was raised against the middle region of PRMT1

Purification: Purified

Immunogen: PRMT1 antibody was raised using the middle region of PRMT1 corresponding to a region with amino acids ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRMT1 Blocking Peptide, (ABIN938122), is also available for use as a blocking control in assays to test for specificity of this PRMT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRMT1

Target: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Alternative Name: PRMT1

Background: PRMT1 is a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4.

Molecular Weight: 40 kDa (MW of target protein)