HSP70 1A antibody (Middle Region)

Catalog No. ABIN629817

This anti-HSP70 1A antibody is a Rabbit Polyclonal antibody detecting HSP70 1A in WB. Suitable for Human, Mouse, Rat, Dog, C. elegans and Zebrafish (Danio rerio).

Quick Overview for HSP70 1A antibody (Middle Region) (ABIN629817)

Target: HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))

Reactivity: Human, Mouse, Rat, Dog, C. elegans, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSP70 1A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HSP70 1A Antibody

Binding Specificity: Middle Region

Specificity: HSPA1 A antibody was raised against the middle region of HSPA1

Purification: Purified

Immunogen: HSPA1 A antibody was raised using the middle region of HSPA1 corresponding to a region with amino acids SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPA1A Blocking Peptide, (ABIN5614097), is also available for use as a blocking control in assays to test for specificity of this HSPA1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSP70 1A

Target: HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))

Alternative Name: HSPA1A

Background: HSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process