PFKL antibody (Middle Region)

Catalog No. ABIN629821

This Rabbit Polyclonal antibody specifically detects PFKL in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for PFKL antibody (Middle Region) (ABIN629821)

Target: PFKL (Phosphofructokinase, Liver (PFKL))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PFKL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PFKL Antibody

Binding Specificity: Middle Region

Specificity: PFKL antibody was raised against the middle region of PFKL

Purification: Purified

Immunogen: PFKL antibody was raised using the middle region of PFKL corresponding to a region with amino acids RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PFKL Blocking Peptide, (ABIN5615326), is also available for use as a blocking control in assays to test for specificity of this PFKL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFKL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PFKL

Target: PFKL (Phosphofructokinase, Liver (PFKL))

Alternative Name: PFKL

Background: Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Warburg Effect