PRMT8 antibody (C-Term)

Catalog No. ABIN629836

Product Details anti-PRMT8 Antibody

Target: PRMT8 (Protein Arginine Methyltransferase 8 (PRMT8))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRMT8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRMT8 antibody was raised against the C terminal of PRMT8

Purification: Purified

Immunogen: PRMT8 antibody was raised using the C terminal of PRMT8 corresponding to a region with amino acids YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRMT8 Blocking Peptide, catalog no. 33R-10164, is also available for use as a blocking control in assays to test for specificity of this PRMT8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRMT8

Target: PRMT8 (Protein Arginine Methyltransferase 8 (PRMT8))

Alternative Name: PRMT8 (PRMT8 Products)

Synonyms: HRMT1L3 antibody, HRMT1L4 antibody, fj34f03 antibody, hrmt1l4 antibody, prmt8 antibody, wu:fj34f03 antibody, zfL3 antibody, Hrmt1l3 antibody, Hrmt1l4 antibody, protein arginine methyltransferase 8 antibody, protein arginine methyltransferase 8b antibody, protein arginine N-methyltransferase 8 antibody, PRMT8 antibody, Prmt8 antibody, prmt8b antibody

Background: PRMT8 probably methylates the guanidino nitrogens of arginyl residues in some proteins.

Molecular Weight: 43 kDa (MW of target protein)