MORF4L1 antibody (Middle Region)

Catalog No. ABIN629857

This Rabbit Polyclonal antibody specifically detects MORF4L1 in WB and IHC. It exhibits reactivity toward Human, Mouse, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for MORF4L1 antibody (Middle Region) (ABIN629857)

Target: MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MORF4L1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-MORF4L1 Antibody

Binding Specificity: Middle Region

Specificity: MORF4 L1 antibody was raised against the middle region of MORF4 1

Purification: Purified

Immunogen: MORF4 L1 antibody was raised using the middle region of MORF4 1 corresponding to a region with amino acids YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ

Application Details

Application Notes: WB: 5-10 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MORF4L1 Blocking Peptide, (ABIN936012), is also available for use as a blocking control in assays to test for specificity of this MORF4L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MORF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MORF4L1

Target: MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))

Alternative Name: MORF4L1

Background: MORF4L1 is a novel chromodomain protein that is present in two distinct multiprotein complexes involved in transcriptional activation.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Chromatin Binding